Lineage for d3a9sc1 (3a9s C:2-360)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1622897Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 1622898Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 1622922Family c.85.1.0: automated matches [227251] (1 protein)
    not a true family
  6. 1622923Protein automated matches [227031] (2 species)
    not a true protein
  7. 1622924Species Geobacillus pallidus [TaxId:33936] [225862] (3 PDB entries)
  8. 1622927Domain d3a9sc1: 3a9s C:2-360 [208170]
    Other proteins in same PDB: d3a9sa2, d3a9sb2, d3a9sc2
    automated match to d1fuia2
    complexed with gol, mn

Details for d3a9sc1

PDB Entry: 3a9s (more details), 1.6 Å

PDB Description: x-ray structure of bacillus pallidus d-arabinose isomerase complex with glycerol
PDB Compounds: (C:) D-arabinose isomerase

SCOPe Domain Sequences for d3a9sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9sc1 c.85.1.0 (C:2-360) automated matches {Geobacillus pallidus [TaxId: 33936]}
akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv
iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp
gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks
ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke
nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv
agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt

SCOPe Domain Coordinates for d3a9sc1:

Click to download the PDB-style file with coordinates for d3a9sc1.
(The format of our PDB-style files is described here.)

Timeline for d3a9sc1: