Lineage for d3a9rb2 (3a9r B:361-590)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402483Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 2402502Family b.43.2.0: automated matches [227252] (1 protein)
    not a true family
  6. 2402503Protein automated matches [227032] (5 species)
    not a true protein
  7. 2402527Species Geobacillus pallidus [TaxId:33936] [225863] (3 PDB entries)
  8. 2402532Domain d3a9rb2: 3a9r B:361-590 [208163]
    Other proteins in same PDB: d3a9ra1, d3a9rb1, d3a9rc1
    automated match to d1fuia1
    complexed with mn, mrd

Details for d3a9rb2

PDB Entry: 3a9r (more details), 1.77 Å

PDB Description: x-ray structures of bacillus pallidus d-arabinose isomerasecomplex with (4r)-2-methylpentane-2,4-diol
PDB Compounds: (B:) D-arabinose isomerase

SCOPe Domain Sequences for d3a9rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9rb2 b.43.2.0 (B:361-590) automated matches {Geobacillus pallidus [TaxId: 33936]}
aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy
yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia
egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi
gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl

SCOPe Domain Coordinates for d3a9rb2:

Click to download the PDB-style file with coordinates for d3a9rb2.
(The format of our PDB-style files is described here.)

Timeline for d3a9rb2: