Lineage for d2zz3b_ (2zz3 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826917Protein automated matches [190130] (11 species)
    not a true protein
  7. 2826964Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries)
  8. 2827002Domain d2zz3b_: 2zz3 B: [208028]
    automated match to d3li0b_
    complexed with 6cn, gol; mutant

Details for d2zz3b_

PDB Entry: 2zz3 (more details), 1.8 Å

PDB Description: covalent complex of orotidine monophosphate decarboxylase d70a mutant from m. thermoautotrophicus with 6-cyano-ump
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2zz3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zz3b_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiaa
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdl

SCOPe Domain Coordinates for d2zz3b_:

Click to download the PDB-style file with coordinates for d2zz3b_.
(The format of our PDB-style files is described here.)

Timeline for d2zz3b_: