Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188668] (7 PDB entries) |
Domain d2zydb1: 2zyd B:2-176 [208010] Other proteins in same PDB: d2zyda2, d2zydb2 automated match to d1pgja2 complexed with glo |
PDB Entry: 2zyd (more details), 1.5 Å
SCOPe Domain Sequences for d2zydb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zydb1 c.2.1.0 (B:2-176) automated matches {Escherichia coli K-12 [TaxId: 83333]} skqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefv esletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfn figtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigad
Timeline for d2zydb1: