SCOPe 2.07: Domain d2zfze_: 2zfz E:

Lineage for d2zfze_ (2zfz E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.0: automated matches [194896] (1 protein)
   not a true family

6. Protein automated matches [194897] (4 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [194898] (3 PDB entries)

8. Domain d2zfze_: 2zfz E: [207854]
   automated match to d3buef_
   protein/DNA complex; complexed with arg, gai

Details for d2zfze_

PDB Entry: 2zfz, 1.85 Å

PDB Description: crystal structure of the c-terminal domain hexamer of argr from mycobacterium tuberculosis in complex with arginine

PDB Compounds: (E:) Arginine repressor

SCOPe Domain Sequences for d2zfze_:

Sequence; same for both SEQRES and ATOM records:

>d2zfze_ d.74.2.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gtdrmarllgellvstddsgnlavlrtppgaahylasaidraalpqvvgtiagddtilvv
arepttgaqlagmfenlr

Timeline for d2zfze_:

• d2zfze_ first appeared in SCOPe 2.03
  
• d2zfze_ appears in SCOPe 2.06
  
• d2zfze_ appears in the current release, SCOPe 2.08