Lineage for d2zf5y2 (2zf5 Y:248-494)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606509Species Thermococcus kodakarensis [TaxId:69014] [225454] (1 PDB entry)
  8. 1606513Domain d2zf5y2: 2zf5 Y:248-494 [207849]
    automated match to d3ezwd2

Details for d2zf5y2

PDB Entry: 2zf5 (more details), 2.4 Å

PDB Description: Crystal Structure of highly thermostable glycerol kinase from a hyperthermophilic archaeon
PDB Compounds: (Y:) glycerol kinase

SCOPe Domain Sequences for d2zf5y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zf5y2 c.55.1.0 (Y:248-494) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
aafeagmvkatygtgsfilvntdkmvlysdnllttiawglngrvsyalegsifvtgaavq
wlrdgikiikhaseteelatklesnegvyfvpafvglgapywdqfargiiigitrgtgre
hlaratleaiayltrdvvdemeklvqikelrvdggatandflmqfqadilnrkvirpvvk
ettalgaaylaglavdywadtreiaelwkaerifepkmdektrerlykgwkeavkramgw
akvvdsa

SCOPe Domain Coordinates for d2zf5y2:

Click to download the PDB-style file with coordinates for d2zf5y2.
(The format of our PDB-style files is described here.)

Timeline for d2zf5y2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zf5y1