![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (49 species) not a true protein |
![]() | Species Thermococcus kodakarensis [TaxId:69014] [225454] (1 PDB entry) |
![]() | Domain d2zf5o1: 2zf5 O:1-247 [207846] automated match to d1glfo1 |
PDB Entry: 2zf5 (more details), 2.4 Å
SCOPe Domain Sequences for d2zf5o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zf5o1 c.55.1.0 (O:1-247) automated matches {Thermococcus kodakarensis [TaxId: 69014]} mekfvlsldegttsaraiifdresnihgigqyefpqhyprpgwvehnpeeiwdaqlraik daiqsariepnqiaaigvtnqrettlvwdkdgkplynaivwqcrrtaemveeikreygtm ikektglvpdayfsasklkwlldnvpglrekaekgevmfgtvdtfliyrltgehvtdysn asrtmlfnikkldwddellelfdipesvlpevressevygytkkellgaeipvsgdagdq qaalfgq
Timeline for d2zf5o1: