SCOPe 2.06: Domain d2zf5o1: 2zf5 O:1-247

Lineage for d2zf5o1 (2zf5 O:1-247)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:69014] [225454] (1 PDB entry)

8. Domain d2zf5o1: 2zf5 O:1-247 [207846]
   automated match to d1glfo1

Details for d2zf5o1

PDB Entry: 2zf5, 2.4 Å

PDB Description: Crystal Structure of highly thermostable glycerol kinase from a hyperthermophilic archaeon

PDB Compounds: (O:) glycerol kinase

SCOPe Domain Sequences for d2zf5o1:

Sequence; same for both SEQRES and ATOM records:

>d2zf5o1 c.55.1.0 (O:1-247) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mekfvlsldegttsaraiifdresnihgigqyefpqhyprpgwvehnpeeiwdaqlraik
daiqsariepnqiaaigvtnqrettlvwdkdgkplynaivwqcrrtaemveeikreygtm
ikektglvpdayfsasklkwlldnvpglrekaekgevmfgtvdtfliyrltgehvtdysn
asrtmlfnikkldwddellelfdipesvlpevressevygytkkellgaeipvsgdagdq
qaalfgq

Timeline for d2zf5o1:

• d2zf5o1 first appeared in SCOPe 2.03
  
• d2zf5o1 appears in SCOPe 2.05
  
• d2zf5o1 appears in SCOPe 2.07
  
• d2zf5o1 appears in the current release, SCOPe 2.08