Lineage for d1a6zc1 (1a6z C:182-275)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655072Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species)
  7. 655073Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries)
  8. 655078Domain d1a6zc1: 1a6z C:182-275 [20783]
    Other proteins in same PDB: d1a6za2, d1a6zb_, d1a6zc2, d1a6zd_

Details for d1a6zc1

PDB Entry: 1a6z (more details), 2.6 Å

PDB Description: hfe (human) hemochromatosis protein
PDB Compounds: (C:) hfe

SCOP Domain Sequences for d1a6zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6zc1 b.1.1.2 (C:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

SCOP Domain Coordinates for d1a6zc1:

Click to download the PDB-style file with coordinates for d1a6zc1.
(The format of our PDB-style files is described here.)

Timeline for d1a6zc1: