Lineage for d2zc8b2 (2zc8 B:126-368)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2100013Species Thermus thermophilus HB8 [TaxId:300852] [225416] (1 PDB entry)
  8. 2100015Domain d2zc8b2: 2zc8 B:126-368 [207813]
    Other proteins in same PDB: d2zc8a1, d2zc8b1
    automated match to d1wuea1

Details for d2zc8b2

PDB Entry: 2zc8 (more details), 1.95 Å

PDB Description: Crystal structure of N-Acylamino Acid Racemase from Thermus thermophilus HB8
PDB Compounds: (B:) N-acylamino acid racemase

SCOPe Domain Sequences for d2zc8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc8b2 c.1.11.0 (B:126-368) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
vrqavevgvslgiqpsvedtlrvverhleegyrriklkikpgwdyevlkavreafpeatl
tadansayslanlaqlkrldelrldyieqplayddlldhaklqrelstpicldesltgae
karkaielgagrvfnvkparlgghgeslrvhalaesagiplwmggmleagvgrahnlhla
tlpgftkpgdvssasryweediveealeakdglmpvpegvgigvhlklpfvervtlwqry
msa

SCOPe Domain Coordinates for d2zc8b2:

Click to download the PDB-style file with coordinates for d2zc8b2.
(The format of our PDB-style files is described here.)

Timeline for d2zc8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zc8b1