SCOPe 2.08: Domain d2yy9b1: 2yy9 B:8-114

Lineage for d2yy9b1 (2yy9 B:8-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188594] (2 PDB entries)

8. Domain d2yy9b1: 2yy9 B:8-114 [207740]
   Other proteins in same PDB: d2yy9a2, d2yy9b2
   automated match to d3b84a_

Details for d2yy9b1

PDB Entry: 2yy9, 2.6 Å

PDB Description: Crystal structure of BTB domain from mouse HKR3

PDB Compounds: (B:) Zinc finger and BTB domain-containing protein 48

SCOPe Domain Sequences for d2yy9b1:

Sequence; same for both SEQRES and ATOM records:

>d2yy9b1 d.42.1.0 (B:8-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqriygdgtggsvvlpa
gfaeifgllldffytghlaltsgnrdqvllaakelrvpeavelcqsf

Timeline for d2yy9b1:

• d2yy9b1 first appeared in SCOPe 2.03, called d2yy9b_
  
• d2yy9b1 appears in SCOPe 2.07