Lineage for d2ywwb1 (2yww B:8-99)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193033Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2193175Family d.58.2.0: automated matches [227215] (1 protein)
    not a true family
  6. 2193176Protein automated matches [226953] (1 species)
    not a true protein
  7. 2193177Species Methanocaldococcus jannaschii [TaxId:2190] [225362] (1 PDB entry)
  8. 2193179Domain d2ywwb1: 2yww B:8-99 [207736]
    Other proteins in same PDB: d2ywwa2, d2ywwb2
    automated match to d1pg5b1
    complexed with atp, zn

Details for d2ywwb1

PDB Entry: 2yww (more details), 2 Å

PDB Description: Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2ywwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywwb1 d.58.2.0 (B:8-99) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
kvkkitngtvidhidagkalmvfkvlnvpketsvmiainvpskkkgkkdilkiegielkk
edvdkislispdvtiniirngkvveklkpqip

SCOPe Domain Coordinates for d2ywwb1:

Click to download the PDB-style file with coordinates for d2ywwb1.
(The format of our PDB-style files is described here.)

Timeline for d2ywwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ywwb2