Lineage for d2ywwa1 (2yww A:8-99)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2516948Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2517090Family d.58.2.0: automated matches [227215] (1 protein)
    not a true family
  6. 2517091Protein automated matches [226953] (1 species)
    not a true protein
  7. 2517092Species Methanocaldococcus jannaschii [TaxId:2190] [225362] (1 PDB entry)
  8. 2517093Domain d2ywwa1: 2yww A:8-99 [207734]
    Other proteins in same PDB: d2ywwa2, d2ywwb2
    automated match to d1pg5b1
    complexed with atp, zn

Details for d2ywwa1

PDB Entry: 2yww (more details), 2 Å

PDB Description: Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
PDB Compounds: (A:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2ywwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywwa1 d.58.2.0 (A:8-99) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
kvkkitngtvidhidagkalmvfkvlnvpketsvmiainvpskkkgkkdilkiegielkk
edvdkislispdvtiniirngkvveklkpqip

SCOPe Domain Coordinates for d2ywwa1:

Click to download the PDB-style file with coordinates for d2ywwa1.
(The format of our PDB-style files is described here.)

Timeline for d2ywwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ywwa2