SCOPe 2.08: Domain d2ywwa2: 2yww A:100-148

Lineage for d2ywwa2 (2yww A:100-148)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.0: automated matches [227216] (1 protein)
   not a true family

6. Protein automated matches [226954] (1 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [225363] (1 PDB entry)

8. Domain d2ywwa2: 2yww A:100-148 [207735]
   Other proteins in same PDB: d2ywwa1, d2ywwb1
   automated match to d1pg5b2
   complexed with atp, zn

Details for d2ywwa2

PDB Entry: 2yww, 2 Å

PDB Description: Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii

PDB Compounds: (A:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2ywwa2:

Sequence; same for both SEQRES and ATOM records:

>d2ywwa2 g.41.7.0 (A:100-148) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
deiegtlkctnpncitnkekvrgkfkiesknplkircyycekflnevif

Timeline for d2ywwa2:

• d2ywwa2 first appeared in SCOPe 2.03
  
• d2ywwa2 appears in SCOPe 2.07