Lineage for d2yoxa_ (2yox A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039520Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries)
  8. 2039525Domain d2yoxa_: 2yox A: [207697]
    automated match to d2yoya_
    complexed with cu1

Details for d2yoxa_

PDB Entry: 2yox (more details), 1.9 Å

PDB Description: Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction
PDB Compounds: (A:) rbam17540

SCOPe Domain Sequences for d2yoxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yoxa_ b.1.18.0 (A:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

SCOPe Domain Coordinates for d2yoxa_:

Click to download the PDB-style file with coordinates for d2yoxa_.
(The format of our PDB-style files is described here.)

Timeline for d2yoxa_: