Lineage for d2yhec2 (2yhe C:539-660)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574864Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2574865Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2574928Family d.106.1.0: automated matches [191568] (1 protein)
    not a true family
  6. 2574929Protein automated matches [190987] (4 species)
    not a true protein
  7. 2574933Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries)
  8. 2574936Domain d2yhec2: 2yhe C:539-660 [207596]
    Other proteins in same PDB: d2yhea1, d2yhea3, d2yheb1, d2yheb3, d2yhec1, d2yhec3, d2yhed1, d2yhed3, d2yhee1, d2yhee3, d2yhef1, d2yhef3
    automated match to d2cfua1
    complexed with so4, zn

Details for d2yhec2

PDB Entry: 2yhe (more details), 2.7 Å

PDB Description: structure determination of the stereoselective inverting sec- alkylsulfatase pisa1 from pseudomonas sp.
PDB Compounds: (C:) sec-alkyl sulfatase

SCOPe Domain Sequences for d2yhec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhec2 d.106.1.0 (C:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
ve

SCOPe Domain Coordinates for d2yhec2:

Click to download the PDB-style file with coordinates for d2yhec2.
(The format of our PDB-style files is described here.)

Timeline for d2yhec2: