Lineage for d2yc5a_ (2yc5 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1614914Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1614915Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1615477Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 1615478Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 1615498Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142690] (7 PDB entries)
    Uniprot P69834 75-300
  8. 1615500Domain d2yc5a_: 2yc5 A: [207545]
    automated match to d2yc3a_
    complexed with 6bc, act, cd, cu, mg, na, zn

Details for d2yc5a_

PDB Entry: 2yc5 (more details), 1.6 Å

PDB Description: inhibitors of the herbicidal target ispd
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic

SCOPe Domain Sequences for d2yc5a_:

Sequence, based on SEQRES records: (download)

>d2yc5a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
difeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
eglevtddvsiveylkhpvyvsqgsytnikvttpddlllaerils

Sequence, based on observed residues (ATOM records): (download)

>d2yc5a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
meksvsvillagsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyee
sidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavga
avlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseglevtdd
vsiveylkhpvyvsqgsytnikvttpddlllaerils

SCOPe Domain Coordinates for d2yc5a_:

Click to download the PDB-style file with coordinates for d2yc5a_.
(The format of our PDB-style files is described here.)

Timeline for d2yc5a_: