Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (12 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [226343] (2 PDB entries) |
Domain d2ybvg1: 2ybv G:23-150 [207530] Other proteins in same PDB: d2ybva2, d2ybvb_, d2ybvc2, d2ybvd_, d2ybve2, d2ybvf_, d2ybvg2, d2ybvh_, d2ybvi2, d2ybvj_, d2ybvk2, d2ybvl_, d2ybvm2, d2ybvn_, d2ybvo2, d2ybvp_ automated match to d1wdda2 complexed with cl |
PDB Entry: 2ybv (more details), 2.3 Å
SCOPe Domain Sequences for d2ybvg1:
Sequence, based on SEQRES records: (download)
>d2ybvg1 d.58.9.0 (G:23-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwtdlltdldrykg ccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripv aylktfqg
>d2ybvg1 d.58.9.0 (G:23-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt fqg
Timeline for d2ybvg1: