Lineage for d2yavf_ (2yav F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2556875Family d.58.4.17: SOR-like [143278] (2 proteins)
    Pfam PF07682; duplication: consists of two similar domains
  6. 2556879Protein automated matches [190550] (3 species)
    not a true protein
  7. 2556880Species Acidianus ambivalens [TaxId:2283] [187530] (10 PDB entries)
  8. 2556886Domain d2yavf_: 2yav F: [207508]
    automated match to d2yaxc_
    complexed with act, cl, fe, zn

Details for d2yavf_

PDB Entry: 2yav (more details), 1.7 Å

PDB Description: zn inhibited sulfur oxygenase reductase
PDB Compounds: (F:) Sulfur oxygenase/reductase

SCOPe Domain Sequences for d2yavf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yavf_ d.58.4.17 (F:) automated matches {Acidianus ambivalens [TaxId: 2283]}
pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcyscasqmiwgpwepiyeiiy
anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
wreylne

SCOPe Domain Coordinates for d2yavf_:

Click to download the PDB-style file with coordinates for d2yavf_.
(The format of our PDB-style files is described here.)

Timeline for d2yavf_: