Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (19 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189439] (11 PDB entries) |
Domain d2y1te_: 2y1t E: [207455] automated match to d2bazc_ complexed with dud |
PDB Entry: 2y1t (more details), 1.89 Å
SCOPe Domain Sequences for d2y1te_:
Sequence, based on SEQRES records: (download)
>d2y1te_ b.85.4.0 (E:) automated matches {Bacillus subtilis [TaxId: 1423]} mqikikyldetqtrinkmeqgdwidlraaedvaikkdefklvplgvamelpegyeahvvp rsstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpav dlievdrl
>d2y1te_ b.85.4.0 (E:) automated matches {Bacillus subtilis [TaxId: 1423]} mqikikyldetqtrinkmqgdwidlraaedvaikkdefklvplgvamelpegyeahvvpr sstyknfgviqtnsmgvidesykgdndfwffpayalrdtkikkgdricqfrimkkmpavd lievdrl
Timeline for d2y1te_: