Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [187989] (15 PDB entries) |
Domain d2xxjb1: 2xxj B:1-141 [207410] Other proteins in same PDB: d2xxja2, d2xxjb2, d2xxjc2, d2xxjd2 automated match to d1llda1 complexed with nad, oxm, so4; mutant |
PDB Entry: 2xxj (more details), 1.96 Å
SCOPe Domain Sequences for d2xxjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxjb1 c.2.1.0 (B:1-141) automated matches {Thermus thermophilus [TaxId: 300852]} mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd vmtqvayalsglppgrvvgsg
Timeline for d2xxjb1: