SCOPe 2.03: Domain d2xxjb1: 2xxj B:1-141

Lineage for d2xxjb1 (2xxj B:1-141)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [187989] (15 PDB entries)

8. Domain d2xxjb1: 2xxj B:1-141 [207410]
   Other proteins in same PDB: d2xxja2, d2xxjb2, d2xxjc2, d2xxjd2
   automated match to d1llda1
   complexed with nad, oxm, so4; mutant

Details for d2xxjb1

PDB Entry: 2xxj, 1.96 Å

PDB Description: penta mutant of lactate dehydrogenase from thermus thermophilus, ternary complex

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2xxjb1:

Sequence; same for both SEQRES and ATOM records:

>d2xxjb1 c.2.1.0 (B:1-141) automated matches {Thermus thermophilus [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvwag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayalsglppgrvvgsg

Timeline for d2xxjb1:

• d2xxjb1 is new in SCOPe 2.03-stable
  
• d2xxjb1 appears in SCOPe 2.04
  
• d2xxjb1 appears in the current release, SCOPe 2.08