SCOPe 2.08: Domain d2hlaa1: 2hla A:182-270

Lineage for d2hlaa1 (2hla A:182-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d2hlaa1: 2hla A:182-270 [20739]
   Other proteins in same PDB: d2hlaa2, d2hlab_

Details for d2hlaa1

PDB Entry: 2hla, 2.6 Å

PDB Description: specificity pockets for the side chains of peptide antigens in hla- aw68

PDB Compounds: (A:) CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-Aw68)

SCOPe Domain Sequences for d2hlaa1:

Sequence; same for both SEQRES and ATOM records:

>d2hlaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpl

Timeline for d2hlaa1:

• d2hlaa1 first appeared (with stable ids) in SCOP 1.55
  
• d2hlaa1 appears in SCOPe 2.07