Lineage for d2hlaa2 (2hla A:1-181)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163098Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2163280Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (4 PDB entries)
  8. 2163284Domain d2hlaa2: 2hla A:1-181 [38259]
    Other proteins in same PDB: d2hlaa1, d2hlab_

Details for d2hlaa2

PDB Entry: 2hla (more details), 2.6 Å

PDB Description: specificity pockets for the side chains of peptide antigens in hla- aw68
PDB Compounds: (A:) CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-Aw68)

SCOPe Domain Sequences for d2hlaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlaa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68 [TaxId: 9606]}
gshsmryfytsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqmmygcdvgsdgrflrgyrqdaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2hlaa2:

Click to download the PDB-style file with coordinates for d2hlaa2.
(The format of our PDB-style files is described here.)

Timeline for d2hlaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlaa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2hlab_