Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226227] (6 PDB entries) |
Domain d2xsfa_: 2xsf A: [207329] automated match to d3md1b_ complexed with gol, so4 |
PDB Entry: 2xsf (more details), 1.7 Å
SCOPe Domain Sequences for d2xsfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xsfa_ d.58.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gkimpntvfvggidvrmdeteirsffarygsvkevkiitdrtgvskgygfvsfyndvdvq kivesqinfhgkklklgpair
Timeline for d2xsfa_: