Lineage for d2xp8a2 (2xp8 A:51-163)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644293Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1644294Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1644431Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
    Domain 1 is a WW-domain
  7. 1644432Species Human (Homo sapiens) [TaxId:9606] [54548] (39 PDB entries)
  8. 1644465Domain d2xp8a2: 2xp8 A:51-163 [207302]
    Other proteins in same PDB: d2xp8a1
    automated match to d2itka2
    complexed with 12p, 4fy

Details for d2xp8a2

PDB Entry: 2xp8 (more details), 2.1 Å

PDB Description: discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2xp8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xp8a2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

SCOPe Domain Coordinates for d2xp8a2:

Click to download the PDB-style file with coordinates for d2xp8a2.
(The format of our PDB-style files is described here.)

Timeline for d2xp8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xp8a1