Lineage for d2xnja2 (2xnj A:110-256)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2467996Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2468084Protein automated matches [226995] (7 species)
    not a true protein
  7. 2468096Species Escherichia coli [TaxId:562] [226085] (1 PDB entry)
  8. 2468097Domain d2xnja2: 2xnj A:110-256 [207284]
    Other proteins in same PDB: d2xnja1, d2xnjb1
    automated match to d1fdra2
    complexed with fad, gol, na, nap, trs, zn

Details for d2xnja2

PDB Entry: 2xnj (more details), 1.9 Å

PDB Description: crystal structure of an engineered ferredoxin(flavodoxin) nadp(h) reductase (fpr) from escherichia coli
PDB Compounds: (A:) ferredoxin nadp-h reductase

SCOPe Domain Sequences for d2xnja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xnja2 c.25.1.1 (A:110-256) automated matches {Escherichia coli [TaxId: 562]}
devphcetlwmlatgtaigpylsilrlgkdldrfknlvlvhaaryaadlsylplmqelek
ryegklriqtvvsretaagsltgripaliesgelestiglpmnketshvmlcgnpqmvrd
tqqllketrqmtkhlrrrpghmtaehy

SCOPe Domain Coordinates for d2xnja2:

Click to download the PDB-style file with coordinates for d2xnja2.
(The format of our PDB-style files is described here.)

Timeline for d2xnja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xnja1