Lineage for d2xh8a_ (2xh8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912825Species Salmonella enterica [TaxId:90371] [226119] (1 PDB entry)
  8. 2912826Domain d2xh8a_: 2xh8 A: [207251]
    automated match to d2xqva_
    complexed with na, so4; mutant

Details for d2xh8a_

PDB Entry: 2xh8 (more details), 2.08 Å

PDB Description: x-ray structure of 119-141 znua deletion mutant from salmonella enterica.
PDB Compounds: (A:) zinc abc transporter, periplasmic zinc-binding protein

SCOPe Domain Sequences for d2xh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xh8a_ c.92.2.0 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
avvaslkplgfiasaiadgvtdtqvllpdgasehdyslrpsdvkrlqgadlvvwvgpeme
afmeksvrnipdnkqvtiaqladvkpllmkgageynmhlwlspeiaratavaiheklvel
mpqsrakldanlkdfeaqlaatdkqvgnelaplkgkgyfvfhdaygyyekhygltplghf
tvnpeiqpgaqrlheirtqlveqkatcvfaepqfrpavveavargtsvrmgtldplgtni
klgktsysaflsqlanqyasclkg

SCOPe Domain Coordinates for d2xh8a_:

Click to download the PDB-style file with coordinates for d2xh8a_.
(The format of our PDB-style files is described here.)

Timeline for d2xh8a_: