SCOPe 2.08: Domain d2xh7b2: 2xh7 B:141-436

Lineage for d2xh7b2 (2xh7 B:141-436)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries)

8. Domain d2xh7b2: 2xh7 B:141-436 [207250]
   Other proteins in same PDB: d2xh7a1, d2xh7a3, d2xh7b1, d2xh7b3
   automated match to d1pdza1
   complexed with 2pg, mg; mutant

Details for d2xh7b2

PDB Entry: 2xh7, 1.8 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the d321a mutant of yeast enolase 1

PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d2xh7b2:

Sequence; same for both SEQRES and ATOM records:

>d2xh7b2 c.1.11.0 (B:141-436) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad
altvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted
tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

Timeline for d2xh7b2:

• d2xh7b2 first appeared in SCOPe 2.03
  
• d2xh7b2 appears in SCOPe 2.07