SCOPe 2.08: Domain d2xh7b1: 2xh7 B:1-140

Lineage for d2xh7b1 (2xh7 B:1-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries)

8. Domain d2xh7b1: 2xh7 B:1-140 [207249]
   Other proteins in same PDB: d2xh7a2, d2xh7a3, d2xh7b2, d2xh7b3
   automated match to d1pdza2
   complexed with 2pg, mg; mutant

Details for d2xh7b1

PDB Entry: 2xh7, 1.8 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the d321a mutant of yeast enolase 1

PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d2xh7b1:

Sequence; same for both SEQRES and ATOM records:

>d2xh7b1 d.54.1.0 (B:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlsksk

Timeline for d2xh7b1:

• d2xh7b1 first appeared in SCOPe 2.03
  
• d2xh7b1 appears in SCOPe 2.07