SCOPe 2.08: Domain d2xcga2: 2xcg A:290-401

Lineage for d2xcga2 (2xcg A:290-401)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)

8. Domain d2xcga2: 2xcg A:290-401 [207178]
   Other proteins in same PDB: d2xcga1, d2xcgb1
   automated match to d1s3ea2
   complexed with 3pl, c15, fa8, xcg

Details for d2xcga2

PDB Entry: 2xcg, 1.9 Å

PDB Description: tranylcypromine-inhibited human monoamine oxidase b in complex with 2- (2-benzofuranyl)-2-imidazoline

PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d2xcga2:

Sequence; same for both SEQRES and ATOM records:

>d2xcga2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d2xcga2:

• d2xcga2 first appeared in SCOPe 2.03
  
• d2xcga2 appears in SCOPe 2.07