| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
| Protein Monoamine oxidase B [69673] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries) |
| Domain d2xcgb2: 2xcg B:290-401 [207180] Other proteins in same PDB: d2xcga1, d2xcgb1 automated match to d1s3ea2 complexed with 3pl, c15, fa8, xcg |
PDB Entry: 2xcg (more details), 1.9 Å
SCOPe Domain Sequences for d2xcgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xcgb2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d2xcgb2: