SCOPe 2.04: Domain d2wusa1: 2wus A:2-140

Lineage for d2wusa1 (2wus A:2-140)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Prokaryotic actin homolog MreB [64087] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [64088] (4 PDB entries)

8. Domain d2wusa1: 2wus A:2-140 [207032]
   automated match to d1jcfa1

Details for d2wusa1

PDB Entry: 2wus, 2.9 Å

PDB Description: bacterial actin mreb assembles in complex with cell shape protein rodz

PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d2wusa1:

Sequence; same for both SEQRES and ATOM records:

>d2wusa1 c.55.1.1 (A:2-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
lrkdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatika
irpmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildaglea
gaskvflieepmaaaigsn

Timeline for d2wusa1:

• d2wusa1 first appeared in SCOPe 2.03
  
• d2wusa1 appears in SCOPe 2.05
  
• d2wusa1 appears in the current release, SCOPe 2.08