SCOPe 2.04: Domain d2whub_: 2whu B:

Lineage for d2whub_ (2whu B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries)

8. Domain d2whub_: 2whu B: [206835]
   automated match to d3neda_

Details for d2whub_

PDB Entry: 2whu, 2.65 Å

PDB Description: fluorescent protein mkeima at ph 8.0

PDB Compounds: (B:) Large stokes shift fluorescent protein

SCOPe Domain Sequences for d2whub_:

Sequence; same for both SEQRES and ATOM records:

>d2whub_ d.22.1.1 (B:) automated matches {Montipora sp. [TaxId: 321802]}
sviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspql
qygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgncfiynvkis
genfppngpvmqkktqgwepsterlfardgmligndymalkleggghylcefkstykakk
pvrmpgrheidrkldvtshnrdytsveqceiaiarhsl

Timeline for d2whub_:

• d2whub_ first appeared in SCOPe 2.03
  
• d2whub_ appears in SCOPe 2.05
  
• d2whub_ appears in the current release, SCOPe 2.08