Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Montipora sp. [TaxId:321802] [189025] (4 PDB entries) |
Domain d2whsd_: 2whs D: [206829] automated match to d3neda_ complexed with so4 |
PDB Entry: 2whs (more details), 2.1 Å
SCOPe Domain Sequences for d2whsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2whsd_ d.22.1.1 (D:) automated matches {Montipora sp. [TaxId: 321802]} lvprgshmvsviakqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpf awdilspqlqygsipftkypedipdyfkqsfpegytwersmnfedgavctvsndssiqgn cfiynvkisgenfppngpvmqkktqgwepsterlfardgmligndymalkleggghylce fkstykakkpvrmpgrheidrkldvtshnrdytsveqceiaiarhsllg
Timeline for d2whsd_: