SCOPe 2.06: Domain d2wcaa1: 2wca A:5-126

Lineage for d2wcaa1 (2wca A:5-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)

6. Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
   Uniprot Q89ZI2 25-147

8. Domain d2wcaa1: 2wca A:5-126 [206763]
   Other proteins in same PDB: d2wcaa2, d2wcaa3
   automated match to d2j47a3
   complexed with ca, np6

Details for d2wcaa1

PDB Entry: 2wca, 2.3 Å

PDB Description: btgh84 in complex with n-butyl pugnac

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2wcaa1:

Sequence, based on SEQRES records:

>d2wcaa1 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps

Sequence, based on observed residues (ATOM records):

>d2wcaa1 d.92.2.3 (A:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgmlisigekgdksvrkys
rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

Timeline for d2wcaa1:

• d2wcaa1 first appeared in SCOPe 2.03
  
• d2wcaa1 appears in SCOPe 2.05
  
• d2wcaa1 appears in SCOPe 2.07
  
• d2wcaa1 appears in the current release, SCOPe 2.08