Lineage for d2w7qb_ (2w7q B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077315Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2077316Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2077353Family b.125.1.0: automated matches [191645] (1 protein)
    not a true family
  6. 2077354Protein automated matches [191184] (3 species)
    not a true protein
  7. 2077364Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225807] (1 PDB entry)
  8. 2077366Domain d2w7qb_: 2w7q B: [206691]
    automated match to d2zpda_
    complexed with gol

Details for d2w7qb_

PDB Entry: 2w7q (more details), 1.88 Å

PDB Description: structure of pseudomonas aeruginosa lola
PDB Compounds: (B:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d2w7qb_:

Sequence, based on SEQRES records: (download)

>d2w7qb_ b.125.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
saavqrltgllnkaqtltarfsqltldgsgtrlqetagqlslkrpglfrwhtdapneqll
isngekvwlydpdleqvtiqkldqrltqtpalllsgdiskisesfaitykeggnvvdfvl
kpktkdtlfdtlrlsfrsgkvndmqmidgvgqrtnilffdvkmnealdakqftfdvppgv
dviqe

Sequence, based on observed residues (ATOM records): (download)

>d2w7qb_ b.125.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
saavqrltgllnkaqtltarfsqltldgsgtrlqetagqlslkrpglfrwhtdapneqll
isnekvwlydpdleqvtiqkldqrltqtpalllsgdiskisesfaitykeggnvvdfvlk
pklfdtlrlsfrsgkvndmqmidgvgqrtnilffdvkmnealdakqftfdvppgvdviqe

SCOPe Domain Coordinates for d2w7qb_:

Click to download the PDB-style file with coordinates for d2w7qb_.
(The format of our PDB-style files is described here.)

Timeline for d2w7qb_: