SCOPe 2.08: Domain d2w7qb_: 2w7q B:

Lineage for d2w7qb_ (2w7q B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
   11 stranded sheet partly folded in a corner-like structure filled with a few short helices

4. Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families)

5. Family b.125.1.0: automated matches [191645] (1 protein)
   not a true family

6. Protein automated matches [191184] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225807] (1 PDB entry)

8. Domain d2w7qb_: 2w7q B: [206691]
   automated match to d2zpda_
   complexed with gol

Details for d2w7qb_

PDB Entry: 2w7q, 1.88 Å

PDB Description: structure of pseudomonas aeruginosa lola

PDB Compounds: (B:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d2w7qb_:

Sequence, based on SEQRES records:

>d2w7qb_ b.125.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
saavqrltgllnkaqtltarfsqltldgsgtrlqetagqlslkrpglfrwhtdapneqll
isngekvwlydpdleqvtiqkldqrltqtpalllsgdiskisesfaitykeggnvvdfvl
kpktkdtlfdtlrlsfrsgkvndmqmidgvgqrtnilffdvkmnealdakqftfdvppgv
dviqe

Sequence, based on observed residues (ATOM records):

>d2w7qb_ b.125.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
saavqrltgllnkaqtltarfsqltldgsgtrlqetagqlslkrpglfrwhtdapneqll
isnekvwlydpdleqvtiqkldqrltqtpalllsgdiskisesfaitykeggnvvdfvlk
pklfdtlrlsfrsgkvndmqmidgvgqrtnilffdvkmnealdakqftfdvppgvdviqe

Timeline for d2w7qb_:

• d2w7qb_ first appeared in SCOPe 2.03
  
• d2w7qb_ appears in SCOPe 2.07