Lineage for d2w7qa_ (2w7q A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411926Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2411927Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2411964Family b.125.1.0: automated matches [191645] (1 protein)
    not a true family
  6. 2411965Protein automated matches [191184] (3 species)
    not a true protein
  7. 2411977Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225807] (1 PDB entry)
  8. 2411978Domain d2w7qa_: 2w7q A: [206690]
    automated match to d2zpda_
    complexed with gol

Details for d2w7qa_

PDB Entry: 2w7q (more details), 1.88 Å

PDB Description: structure of pseudomonas aeruginosa lola
PDB Compounds: (A:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d2w7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w7qa_ b.125.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gsiaiddsaavqrltgllnkaqtltarfsqltldgsgtrlqetagqlslkrpglfrwhtd
apneqllisngekvwlydpdleqvtiqkldqrltqtpalllsgdiskisesfaitykegg
nvvdfvlkpktkdtlfdtlrlsfrsgkvndmqmidgvgqrtnilffdvkmnealdakqft
fdvppgvdviqe

SCOPe Domain Coordinates for d2w7qa_:

Click to download the PDB-style file with coordinates for d2w7qa_.
(The format of our PDB-style files is described here.)

Timeline for d2w7qa_: