Lineage for d2w71c1 (2w71 C:1-114)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470137Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2470144Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2470147Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)
  8. 2470171Domain d2w71c1: 2w71 C:1-114 [206687]
    Other proteins in same PDB: d2w71a2, d2w71a3, d2w71c2, d2w71c3
    automated match to d1dv1b2
    complexed with cl, l23

Details for d2w71c1

PDB Entry: 2w71 (more details), 1.99 Å

PDB Description: Crystal structure of Biotin carboxylase from E. coli in complex with the imidazole-pyrimidine inhibitor
PDB Compounds: (C:) biotin carboxylase

SCOPe Domain Sequences for d2w71c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w71c1 c.30.1.1 (C:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d2w71c1:

Click to download the PDB-style file with coordinates for d2w71c1.
(The format of our PDB-style files is described here.)

Timeline for d2w71c1: