|  | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) | 
|  | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies | 
|  | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)  | 
|  | Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) | 
|  | Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases | 
|  | Species Escherichia coli [TaxId:562] [56069] (24 PDB entries) | 
|  | Domain d2w6za2: 2w6z A:115-330 [206673] Other proteins in same PDB: d2w6za1, d2w6za3, d2w6zb1, d2w6zb3 automated match to d1dv1b3 complexed with cl, l21 | 
PDB Entry: 2w6z (more details), 1.9 Å
SCOPe Domain Sequences for d2w6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6za2 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d2w6za2: