![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) ![]() |
![]() | Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins) |
![]() | Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
![]() | Species Escherichia coli [TaxId:562] [56069] (19 PDB entries) |
![]() | Domain d2w6za2: 2w6z A:115-330 [206673] Other proteins in same PDB: d2w6za1, d2w6za3, d2w6zb1, d2w6zb3 automated match to d1dv1b3 complexed with cl, l21 |
PDB Entry: 2w6z (more details), 1.9 Å
SCOPe Domain Sequences for d2w6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6za2 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d2w6za2: