SCOPe 2.04: Domain d2vzla1: 2vzl A:9-139

Lineage for d2vzla1 (2vzl A:9-139)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Nostoc sp. [TaxId:1168] [225652] (2 PDB entries)

8. Domain d2vzla1: 2vzl A:9-139 [206544]
   Other proteins in same PDB: d2vzla2
   automated match to d1frna1
   complexed with fad, gol, nad; mutant

Details for d2vzla1

PDB Entry: 2vzl, 1.93 Å

PDB Description: ferredoxin-nadp reductase (mutations: t155g, a160t, l263p and y303s) complexed with nad by cocrystallization

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2vzla1:

Sequence; same for both SEQRES and ATOM records:

>d2vzla1 b.43.4.0 (A:9-139) automated matches {Nostoc sp. [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgke

Timeline for d2vzla1:

• d2vzla1 first appeared in SCOPe 2.03
  
• d2vzla1 appears in SCOPe 2.05
  
• d2vzla1 appears in the current release, SCOPe 2.08