Lineage for d2vx4a_ (2vx4 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095823Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [225524] (4 PDB entries)
  8. 2095826Domain d2vx4a_: 2vx4 A: [206514]
    automated match to d1r7oa_
    complexed with gol, na

Details for d2vx4a_

PDB Entry: 2vx4 (more details), 1.7 Å

PDB Description: cellvibrio japonicus mannanase cjman26c native form
PDB Compounds: (A:) cellvibrio japonicus mannanase cjman26c

SCOPe Domain Sequences for d2vx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vx4a_ c.1.8.0 (A:) automated matches {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
lpalidtqataetralyrnlaklrykhllfghedslaygvhwegdmdrsdvrdvtganpa
vygwelgglelghtanldavnfekmqhwikagysrggvitiswhvfnpvsggnswdktpa
vhelipggarhatlkayldtfvafnegladvdaqgnkhyppiifrpwhehngdwfwwgkg
haseqdyialwrftvhylrdekklrnliyayspdrsridmanfeagylygypgdayvdii
gldnywdvgheantasadeqkaaltaslkqlvqiarskgkiaaltetgnnrltidnfwte
rllgpisadadaseiayvmvwrnanlarekseqffapfpgqataddfkrfyqsevvlfed
elpplyr

SCOPe Domain Coordinates for d2vx4a_:

Click to download the PDB-style file with coordinates for d2vx4a_.
(The format of our PDB-style files is described here.)

Timeline for d2vx4a_: