SCOPe 2.04: Domain d2vsva_: 2vsv A:

Lineage for d2vsva_ (2vsv A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)

8. Domain d2vsva_: 2vsv A: [206441]
   automated match to d3qe1a_

Details for d2vsva_

PDB Entry: 2vsv, 1.82 Å

PDB Description: crystal structure of the pdz domain of human rhophilin-2

PDB Compounds: (A:) rhophilin-2

SCOPe Domain Sequences for d2vsva_:

Sequence; same for both SEQRES and ATOM records:

>d2vsva_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssgvdlgtenlyfqsmprsirftaeegdlgftlrgnapvqvhfldpycsasvagaregdy
ivsiqlvdckwltlsevmkllksfgedeiemkvvsll

Timeline for d2vsva_:

• d2vsva_ first appeared in SCOPe 2.03
  
• d2vsva_ appears in SCOPe 2.05
  
• d2vsva_ appears in the current release, SCOPe 2.08, called d2vsva1