SCOPe 2.04: Domain d2voga_: 2vog A:

Lineage for d2voga_ (2vog A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195067] (4 PDB entries)

8. Domain d2voga_: 2vog A: [206403]
   automated match to d2voia_
   complexed with cl

Details for d2voga_

PDB Entry: 2vog, 1.9 Å

PDB Description: structure of mouse a1 bound to the bmf bh3-domain

PDB Compounds: (A:) bcl-2-related protein a1

SCOPe Domain Sequences for d2voga_:

Sequence, based on SEQRES records:

>d2voga_ f.1.4.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsmaeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksyldd
fhvesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqv
ssfvaefimnntgewirqnggwedgfikkfe

Sequence, based on observed residues (ATOM records):

>d2voga_ f.1.4.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsmaeselmhihslaehylqyvlqvpsqacrvlqrvafsvqkeveknlksylddfhvesi
dtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvssfvae
fimnntgewirqnggwedgfikkfe

Timeline for d2voga_:

• d2voga_ first appeared in SCOPe 2.03
  
• d2voga_ appears in SCOPe 2.05
  
• d2voga_ appears in the current release, SCOPe 2.08, called d2voga1