Lineage for d2vnkc2 (2vnk C:114-272)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468165Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2468166Protein automated matches [226871] (19 species)
    not a true protein
  7. 2468277Species Rhodobacter capsulatus [TaxId:1061] [225020] (7 PDB entries)
  8. 2468283Domain d2vnkc2: 2vnk C:114-272 [206394]
    Other proteins in same PDB: d2vnka1, d2vnkb1, d2vnkc1, d2vnkd1
    automated match to d1a8pa2
    complexed with fad, nap

Details for d2vnkc2

PDB Entry: 2vnk (more details), 1.93 Å

PDB Description: x-ray structure of the ferredoxin-nadp(h) reductase from rhodobacter capsulatus in complex with nadp. form iii at 1. 93 angstroms resolution
PDB Compounds: (C:) nadph:ferredoxin reductase

SCOPe Domain Sequences for d2vnkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vnkc2 c.25.1.0 (C:114-272) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
idallpgkrlwflatgtgiapfaslmrepeayekfdevimmhacrtvaeleygrqlveal
qedpligelvegklkyyptttreefhhmgritdnlasgkvfedlgiapmnpetdramvcg
slafnvdvmkvlesyglreganseprefvvekafvgegi

SCOPe Domain Coordinates for d2vnkc2:

Click to download the PDB-style file with coordinates for d2vnkc2.
(The format of our PDB-style files is described here.)

Timeline for d2vnkc2: