| Class b: All beta proteins [48724] (176 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
| Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
| Protein automated matches [226870] (16 species) not a true protein |
| Species Rhodobacter capsulatus [TaxId:1061] [225019] (7 PDB entries) |
| Domain d2vnha1: 2vnh A:13-113 [206383] Other proteins in same PDB: d2vnha2 automated match to d1a8pa1 complexed with fad, htg, nap |
PDB Entry: 2vnh (more details), 2.27 Å
SCOPe Domain Sequences for d2vnha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vnha1 b.43.4.0 (A:13-113) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
kvlpdaqtvtsvrhwtdtlfsfrvtrpqtlrfrsgefvmigllddngkpimraysiaspa
wdeelefysikvpdgpltsrlqhikvgeqiilrpkpvgtlv
Timeline for d2vnha1: