Lineage for d1jckc1 (1jck C:3-117)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158773Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (15 PDB entries)
  8. 158789Domain d1jckc1: 1jck C:3-117 [20634]
    Other proteins in same PDB: d1jcka2, d1jckb1, d1jckb2, d1jckc2, d1jckd1, d1jckd2

Details for d1jckc1

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen

SCOP Domain Sequences for d1jckc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle

SCOP Domain Coordinates for d1jckc1:

Click to download the PDB-style file with coordinates for d1jckc1.
(The format of our PDB-style files is described here.)

Timeline for d1jckc1: