Lineage for d2vama2 (2vam A:209-315)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201804Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2201805Protein automated matches [226843] (8 species)
    not a true protein
  7. 2201806Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries)
  8. 2201808Domain d2vama2: 2vam A:209-315 [206283]
    Other proteins in same PDB: d2vama1
    automated match to d1rq2a2
    complexed with so4

Details for d2vama2

PDB Entry: 2vam (more details), 2.5 Å

PDB Description: ftsz b. subtilis
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vama2 d.79.2.0 (A:209-315) automated matches {Bacillus subtilis [TaxId: 1423]}
ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt
nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgf

SCOPe Domain Coordinates for d2vama2:

Click to download the PDB-style file with coordinates for d2vama2.
(The format of our PDB-style files is described here.)

Timeline for d2vama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vama1