Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Ureaplasma parvum [TaxId:134821] [225337] (1 PDB entry) |
Domain d2va1e_: 2va1 E: [206280] Other proteins in same PDB: d2va1b2 automated match to d1ybda1 complexed with po4 |
PDB Entry: 2va1 (more details), 2.5 Å
SCOPe Domain Sequences for d2va1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2va1e_ c.73.1.0 (E:) automated matches {Ureaplasma parvum [TaxId: 134821]} mrkqrivikisgaclkqndssiidfikindlaeqiekiskkyivsivlgggniwrgsiak eldmdrnladnmgmmatiinglalenalnhlnvntivlsaikcdklvhessannikkaie keqvmifvagtgfpyfttdscaairaaetessiilmgkngvdgvydsdpkinpnaqfyeh itfnmaltqnlkvmdatalalcqenninllvfnidkpnaivdvlekknkytivsk
Timeline for d2va1e_: