Lineage for d2va1c_ (2va1 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905470Species Ureaplasma parvum [TaxId:134821] [225337] (1 PDB entry)
  8. 2905473Domain d2va1c_: 2va1 C: [206278]
    Other proteins in same PDB: d2va1b2
    automated match to d1ybda1
    complexed with po4

Details for d2va1c_

PDB Entry: 2va1 (more details), 2.5 Å

PDB Description: crystal structure of ump kinase from ureaplasma parvum
PDB Compounds: (C:) uridylate kinase

SCOPe Domain Sequences for d2va1c_:

Sequence, based on SEQRES records: (download)

>d2va1c_ c.73.1.0 (C:) automated matches {Ureaplasma parvum [TaxId: 134821]}
kqrivikisgaclkqndssiidfikindlaeqiekiskkyivsivlgggniwrgsiakel
dmdrnladnmgmmatiinglalenalnhlnvntivlsaikcdklvhessannikkaieke
qvmifvagtgfpyfttdscaairaaetessiilmgkngvdgvydsdpkinpnaqfyehit
fnmaltqnlkvmdatalalcqenninllvfnidkpnaivdvlekknkytivsk

Sequence, based on observed residues (ATOM records): (download)

>d2va1c_ c.73.1.0 (C:) automated matches {Ureaplasma parvum [TaxId: 134821]}
kqrivikisgaclkqndssiidfikindlaeqiekiskkyivsivlgggniwrgsiakel
dmdrnladnmgmmatiinglalenalnhlnvntivlsaikcdklvhessannikkaieke
qvmifvagtgfpyfttdscaairaaetessiilmgkngvdgvydsdaqfyehitfnmalt
qnlkvmdatalalcqenninllvfnidkpnaivdvlekknkytivsk

SCOPe Domain Coordinates for d2va1c_:

Click to download the PDB-style file with coordinates for d2va1c_.
(The format of our PDB-style files is described here.)

Timeline for d2va1c_: